vniigisРоссийский паразитологический журналRussian Journal of Parasitology1998-84352541-7843ВНИИП – филиал ФГБНУ ФНЦ ВИЭВ РАН10.12737/23080vniigis-314Research ArticleЛЕЧЕНИЕ И ПРОФИЛАКТИКАTREATMENT AND PREVENTIONПРОЛОНГИРОВАННЫЕ ФОРМЫ АНТИГЕЛЬМИНТНЫХ ПРЕПАРАТОВPROLONGED FORMS OF ANTHELMINTIC DRUGSСусловВ. В.SuslovV. V.

119571, Москва, пр. Вернадского, 86

119571, Moscow, Vernadsky Prospekt, 86

svvchem@yandex.ruЕнгашеваЕ. С.EngashevaE. S.

123022, Moscow, Zvenigorodskoe Highway, 5

КедикС. А.KedikS. A.

119571, Москва, пр. Вернадского, 86

119571, Moscow, Vernadsky Prospekt, 86

svvchem@yandex.ruШнякЕ. А.ShnyakE. A.

119571, Москва, пр. Вернадского, 86

119571, Moscow, Vernadsky Prospekt, 86

svvchem@yandex.ruМаксимоваП. О.MaximovaP. O.

119571, Москва, пр-т Вернадского, 86

119571, Moscow, Prospekt Vernadskogo, 86 

Московский институт тонкой химической технологииРоссияMITHT named M.V. LomonosovRussian FederationМосковский институт тонкой химической технологииРоссияGNU VNIIVSGERussian FederationМосковский технологический университет (МИТХТ)РоссияMoscow Technological University (MITHT), Chair of GTyPFRussian Federation201616122016384539546Copyright © Суслов В.В., Енгашева Е.С., Кедик С.А., Шняк Е.А., Максимова П.О., 20162016Суслов В.В., Енгашева Е.С., Кедик С.А., Шняк Е.А., Максимова П.О.Suslov V.V., Engasheva E.S., Kedik S.A., Shnyak E.A., Maximova P.O.This work is licensed under a Creative Commons Attribution 4.0 License.https://vniigis.elpub.ru/jour/article/view/314

Цель исследования — провести анализ состояния и перспективы применения пролонгированных форм антигельминтных препаратов в ветеринарии.

Проведен анализ источников литературы, в том числе иностранных авторов, по вопросу разработки и применения в ветеринарии пролонгированных лекарственных форм антигельминтных лекарственных форм. Анализируются данные по кинетике авермектинов и празиквантела в организме животных и приведены сравнительные результаты по изучению зависимости и корреляции фармакокинетических параметров препаратов с их антигельминтной эффективностью. Для предотвращения заражения животных в пастбищный период разрабатываются пролонгированные формы авермектинов, обеспечивающие профилактику заражения в течение длительного периода. Предпринимаются попытки создания пролонгированных лекарственных форм празиквантела для профилактики заражения шистосомами Schistosoma japonicum. Показана возможность получения полимерных микросфер, содержащих ивермектины в форме имплантатов. В качестве растворителей используют N-метилпирролидон, триацетин, бензилбензоат и др. Для пролонгации действия ивермектина предлагаются смеси композита на основе сахарозы, ацетатизобутирата и полимолочной кислоты, что обеспечивает высвобождение ивермектина в течение 80 суток. Описаны пролонгированные формы празиквантела как имплантатов на основе поликапролактона и его смеси с полиэтиленгликолем, которые получают экструдированием расплава смеси празиквантела и полимеров.

Purpose of the research — to conduct analysis of the status and perspective of application of prolonged forms of anthelmintic drugs in veterinary.

Materials and methods. On the topic of development and application of prolonged forms of anthelmintic in veterinary was conducted the analysis of 27 literature sources including 23 foreign authors. Were analyzed the data about kinetics of avermectins and praziquantel in the animals body and comparative results about dependence and correlation of pharmacokinetic parameters with their anthelmintics efficiency.

The results and discussion. Prolonged forms of avermectins which prevent the infections for long period are developing to prevent infection of animals during grazing season. Attempts to create prolonged dosage forms of praziquantel to prevent the Schistosoma japonicum infections are currently in progress. Was shown the possibility of obtaining polymeric microspheres, which contains ivermectins in the form of implants. As solvents are used N-methylpyrrolidone, triacetin, benzyl benzoate etc. Mixes of composite based on sucrose, acetate isobutyrate and polylactic acid is offered for prolongation of the action of ivermectin, which is provides release of ivermectin within 80 days. Were described prolonged forms of praziquantel as the implants on a base of polycaprolactone and it’s mix with polyethylene glycol, which is obtained by extrusion of a melt of a mixture of praziquantel and polymers.

ивермектиныпразиквантелпролонгированные формыимплантатыкинетикаэффективностьгельминтозыvermectinspraziquantelprolonged formsimplantskineticsefficiencyhelminthosisReferencesАрхипов И.А. Антигельминтики: фармакология и применение. — М., 2009. — 404 с.Arhipov I.A. Antigel’mintiki: farmakologiya i primenenie. M., 2009. — 404 s.Демидов Н.В. Антигельминтики в ветеринарии. — М: Колос, 1982. — 367 с.Demidov N.V. Antigel’mintiki v veterinarii. M: Kolos, 1982. — 367 s.Муромцев А.Б., Рыжов В.В. Экология гельминтов крупного рогатого скота в Калининградской области // Известия КГТУ. — 2012. — № 27. — С. 206–212.Muromcev A.B., Ryzhov V.V. Ekologiya gel’mintov krupnogo rogatogo skota v kaliningradskoj oblasti. Izvestiya KGTU, 2012, № 27, S. 206–212.Шульц Р.С., Диков Г.И. Гельминтозы овец и меры борьбы с ними. — 1965. — 256 с.Shul’c R.S., Dikov G.I. Gel’mintozy ovec i mery bor’by s nimi. 1965, 256 s.Camargo J.A., Sapin A., Daloz D., Maincent P. Ivermectin-loaded microparticles for parenteral sustained release: in vitro characterization and effect of some formulation variables. Journal of Microencapsulation, 2010, Vol. 27, No 7, pp. 609–617.Camargo J. A., Sapin A., Daloz D., Maincent P. Ivermectin-loaded microparticles for parenteral sustained release: in vitro characterization and effect of some formulation variables. Journal of Microencapsulation, 2010, Vol. 27, No 7, pp. 609–617.Camargo J.A., Sapin A., Nouvel C. et al. Injectable PLA-based in situ forming implants for controlled release of Ivermectin a BCS Class II drug: solvent selection based on physico-chemical characterization. Drug Development and Industrial Pharmacy, 2013, Vol. 39, No 1, pp. 146–155.Camargo J.A., Sapin A., Nouvel C. et al. Injectable PLA-based in situ forming implants for controlled release of Ivermectin a BCS Class II drug: solvent selection based on physico-chemical characterization. Drug Development and Industrial Pharmacy, 2013, Vol. 39, No 1, pp. 146–155.Campbell W.C. History of avermectin and ivermectin, with notes on the history of other macrocyclic lactone antiparasitic agents. Current pharmaceutical biotechnology, 2012, Vol. 13, No 6, pp. 853–865.Campbell W.C. History of avermectin and ivermectin, with notes on the history of other macrocyclic lactone antiparasiticagents. Current pharmaceutical biotechnology, 2012, Vol. 13, No 6, pp. 853–865.Campbell W.C., Benz G.W. Ivermectin: a review of efficacy and safety. Journal of VeterinaryCampbell W.C., Benz G.W. Ivermectin: a review of efficacy and safety. Journal of Veterinary Pharmacology and Therapeutics, 1984, Vol. 7, No 1, pp. 1–16.Pharmacology and Therapeutics, 1984, Vol. 7, No 1, pp. 1–16.Cheng L., Guo S., Wu W. Characterization and in vitro release of praziquantel from poly(e-caprolactone) implants. International Journal of Pharmaceutics, 2009, Vol. 377, pp. 112–119.Cheng L., Guo S., Wu W. Characterization and in vitro release of praziquantel from poly(e-caprolactone) implants. International Journal of Pharmaceutics, 2009, Vol. 377, pp. 112–119.Cheng L., Lei L., Guo S. et al. Schistosoma japonicum: treatment of different developmental stages in mice with long-acting praziquantel implants. Exp. Parasitol., 2011, Vol. 129, No 3, pp. 254–259.Cheng L., Lei L., Guo S. et al. Schistosoma japonicum: treatment of different developmental stages in mice with long-acting praziquantel implants. Exp. Parasitol., 2011, Vol. 129, No 3, pp. 254–259.Cioli D., Pica–Mattoccia L. Praziquantel. J. Parasitol. Res., 2003, Vol. 90, pp. 3–9.Cioli D., Pica–Mattoccia L. Praziquantel. J. Parasitol. Res., 2003, Vol. 90, pp. 3–9.Clark S.L., Crowley A.J., Schmidt P.G. et al. Long-term delivery of ivermectin by use of poly(D,L-lacticco-glycolic)acid microparticles in dogs. AJVR, 2004, Vol. 65, No 6, pp. 752–757Clark S.L., Crowley A.J., Schmidt P.G. et al. Long-term delivery of ivermectin by use of poly(D,L-lacticco-glycolic)acid microparticles in dogs. AJVR, 2004, Vol. 65, No 6, pp. 752–757Cocquyt C.M. et al. Pharmacokinetics of moxidectin in alpacas following administration of an oral or subcutaneous formulation. Research in veterinary science, 2016, Vol. 105, pp. 160–164.Cocquyt C.M. et al. Pharmacokinetics of moxidectin in alpacas following administration of an oral or subcutaneous formulation. Research in veterinary science, 2016, Vol. 105, pp. 160–164.Corgozinho C.N. C. et al. Long Acting Injectable Formulations: заяв. пат. 12/739,300 США. — 2008.Corgozinho C.N. C. et al. Long Acting Injectable Formulations: заяв. пат. 12/739,300 США. — 2008.Dorati R., Genta I., Colzani B. et al. Preliminary investigation on the design of biodegradable microparticles for ivermectin delivery: set up of formulation parameters. Drug Dev Ind Pharm., 2015, Vol. 41, No 7, pp. 1182–1192.Dorati R., Genta I., Colzani B. et al. Preliminary investigation on the design of biodegradable microparticles for ivermectin delivery: set up of formulation parameters. Drug Dev Ind Pharm., 2015, Vol. 41, No 7, pp. 1182–1192.El–Banna H.A., Goudah A., El–Zorba H. et al. Comparative pharmacokinetics of ivermectin alone and a novel formulation of ivermectin and rafoxanide in calves and sheep. Parasitol. Res., 2008, Vol. 102, pp. 1337–1342.El–Banna H.A., Goudah A., El–Zorba H. et al. Comparative pharmacokinetics of ivermectin alone and a novel formulation of ivermectin and rafoxanide in calves and sheep. Parasitol. Res., 2008, Vol. 102, pp. 1337–1342.Fink D., Porras A., Campbell W. C. Pharmacokinetics of ivermectin in experimentally infected cattle. In: Ivermectin and Abamectin. Springer–Verlag, New York, 1989, pp. 90–113.Fink D., Porras A., Campbell W. C. Pharmacokinetics of ivermectin in experimentally infected cattle. In: Ivermectin and Abamectin. Springer–Verlag, New York, 1989, pp. 90–113.Fogang Y.F. et al. Managing neurocysticercosis: challenges and solutions. International Journal of General Medicine, 2015, Vol. 8, p. 333.Fogang Y.F. et al. Managing neurocysticercosis: challenges and solutions. International Journal of General Medicine, 2015, Vol. 8, p. 333.Hunter J.S., Yoon S., Yazwinski T.A. et al. The efficacy of eprinomectin extended-release injection against naturally acquired nematode parasites of cattle, with special regard to inhibited fourth-stage Ostertagia larvae. Vet. Parasitol., 2013, Vol. 192, No 4, pp. 346–352.Hunter J. S., Yoon S., Yazwinski T. A. et al. The efficacy of eprinomectin extended-release injection against naturally acquired nematode parasites of cattle, with special regard to inhibited fourth-stage Ostertagia larvae. Vet. Parasitol., 2013, Vol. 192, No 4, pp. 346–352.Islam S. Lipophilic and hydrophilic drug loaded PLA/PLGA in situ implants. Int. J. of Pharm. and Pharm. Sci., 2011, Vol. 3, No 3, pp. 181–188.Islam S. Lipophilic and hydrophilic drug loaded PLA/PLGA in situ implants. Int. J. of Pharm. and Pharm. Sci., 2011, Vol. 3, No 3, pp. 181–188.Madhu M., Shaila L., Anwar B. J. Biodegradable injectable implant systems for sustained delivery using poly (lactide-co-glycolide) copolymers. Int. J. Pharm. Pharmaceut. Sci., 2009, Vol. 1, No 1, pp. 103–107.Madhu M., Shaila L., Anwar B. J. Biodegradable injectable implant systems for sustained delivery using poly (lactide-co-glycolide) copolymers. Int. J. Pharm. Pharmaceut. Sci., 2009, Vol. 1, No 1, pp. 103–107.Moreno L. et al. Ivermectin Pharmacokinetics, Metabolism and Tissue/Egg Residue Profiles in Laying Hens. Journal of agricultural and food chemistry, 2015, Vol. 63, No 47, pp. 10327–10332.Moreno L. et al. Ivermectin Pharmacokinetics, Metabolism and Tissue/Egg Residue Profiles in Laying Hens. Journal of agricultural and food chemistry, 2015, Vol. 63, No 47, pp. 10327–10332.Ōmura S., Crump A. Ivermectin: panacea for resource-poor communities? Trends in parasitology, 2014, Vol. 30, No 9, pp. 445–455.Ōmura S., Crump A. Ivermectin: panacea for resource-poor communities? Trends in parasitology, 2014, Vol. 30, No 9, pp. 445–455.Rehbein S., Baggott D. G., Johnson E. G. et al. Nematode burdens of pastured cattle treated once at turnout with eprinomectin extended-release injection. Vet Parasitol., 2013, Vol. 192, No 4, pp. 321–331.Rehbein S., Baggott D. G., Johnson E. G. et al. Nematode burdens of pastured cattle treated once at turnout with eprinomectin extended-release injection. Vet Parasitol., 2013, Vol. 192, No 4, pp. 321–331.Soll M.D. et al. Long acting injectable formulations: пат. 8362086 США. — 2013.Soll M.D. et al. Long acting injectable formulations: пат. 8362086 США. — 2013.Steven L.C., Angela J.C., Paul G.S. et al. Long-term delivery of ivermectin by use of poly(D,L-lacticco-glycolic)acid microparticles in dogs. AJVR, 2004, Vol. 65, No 6, pp. 752–757.Steven L.C., Angela J. C., Paul G. S. et al. Long-term delivery of ivermectin by use of poly(D,L-lacticco-glycolic)acid microparticles in dogs. AJVR, 2004, Vol. 65, No 6, pp. 752–757.Yapar A., Baykara T., Ari N. Investigation of in vitro and in vivo performance of injectable in situ implants. Turk J. Pharm. Sci., 2010, Vol. 7, No 1, pp. 9–20.Yapar A., Baykara T., Ari N. Investigation of in vitro and in vivo performance of injectable in situ implants. Turk J. Pharm. Sci., 2010, Vol. 7, No 1, pp. 9–20.Yapar A., Baykara T., Ari N. Investigation of in vitro and in vivo performance of injectable in situ implants. Turk J. Pharm. Sci., 2010, Vol. 7, No 1, pp. 9–20.

The authors declare that there are no conflicts of interest present.